PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00083.1_g00032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 279aa    MW: 31618.4 Da    PI: 6.249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00083.1_g00032.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.2e-141966148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
  Rsa1.0_00083.1_g00032.1 19 KGLWSPEEDSKLMQYMISNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 66
                             678*******************************************97 PP

2Myb_DNA-binding47.93.1e-1572115146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E++l+++ +  lG++ W+ Ia++++ gRt++++k++w++
  Rsa1.0_00083.1_g00032.1  72 RGAFSPQEEDLIIRFHSVLGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                              89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1781466IPR017930Myb domain
SuperFamilySSF466891.29E-2717113IPR009057Homeodomain-like
SMARTSM007175.9E-111868IPR001005SANT/Myb domain
PfamPF002491.5E-131966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-222073IPR009057Homeodomain-like
CDDcd001675.35E-92266No hitNo description
PROSITE profilePS5129424.33167121IPR017930Myb domain
SMARTSM007176.4E-1571119IPR001005SANT/Myb domain
PfamPF002493.0E-1472115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2574122IPR009057Homeodomain-like
CDDcd001672.54E-1074114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MRKPEVAIAA THQVKKMKKG LWSPEEDSKL MQYMISNGQG CWSDVAKNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE DLIIRFHSVL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKKMSDTSNL VNNSSSSPNA SDSSSNSSSS LEFKDIFGSF MSLQEQGYVN PSLTNMPHNN  180
NPFPAPPHLI SHPYDDDFTP YVDGFCGVTT GVQGELYFPP LECEEGDWYK ADITNHLQDM  240
NTNGAGNVPE SVRMEEYWDL DQLMNAEAPS VYFNFKQNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28191217108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382830.0KF738283.1 Brassica napus MYB transcription factor 46 (MYB46.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013712664.11e-174PREDICTED: transcription factor MYB46-like
RefseqXP_009125868.11e-174PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV21e-159MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A078DVC51e-179A0A078DVC5_BRANA; BnaC02g04390D protein
STRINGBra006166.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-151myb domain protein 46